z-logo
Premium
Purification and characterization of a fructosyltransferase from onion bulbs and its key role in the synthesis of fructo‐oligosaccharides in vivo
Author(s) -
Fujishima Masaki,
Sakai Hideki,
Ueno Keiji,
Takahashi Natsuko,
Onodera Shuichi,
Benkeblia Noureddine,
Shiomi Norio
Publication year - 2005
Publication title -
new phytologist
Language(s) - English
Resource type - Journals
SCImago Journal Rank - 3.742
H-Index - 244
eISSN - 1469-8137
pISSN - 0028-646X
DOI - 10.1111/j.1469-8137.2004.01231.x
Subject(s) - fructan , sephadex , chemistry , inulin , oligosaccharide , biochemistry , size exclusion chromatography , sucrose , enzyme , chromatography , residue (chemistry)
Summary•  A fructosyltransferase that transfers the terminal (2 → 1)‐β‐linked d ‐fructosyl group of fructo‐oligosaccharides (1 F (1‐β‐ d ‐fructofuranosyl) n sucrose, n   1) to HO‐6 of the glucosyl residue and HO‐1 of the fructosyl residue of similar saccharides (1 F (1‐β‐ d ‐fructofuranosyl) m sucrose, m   0) has been purified from an extract of the bulbs of onion ( Allium cepa ). •  Successive column chromatography using DEAE‐Sepharose CL‐6B, Toyopearl HW65, Toyopearl HW55, DEAE‐Sepharose CL‐6B (2nd time), Sephadex G‐100, Concanavalin A Sepharose, and Toyopearl HW‐65 (2nd time) were applied for protein purification. •  The general properties of the enzyme, were as follows: molecular masses of 66 kDa (gel filtration chromatography), and of 52 kDa and 25 kDa (SDS‐PAGE); optimum pH of c . 5.68, stable at 20–40°C for 15 min; stable in a range of pH 5.30–6.31 at 30°C for 30 min, inhibited by Hg 2+ , Ag + , p ‐chloromercuribenzoic acid ( p‐ CMB) and sodium dodecyl sulfate (SDS), activated by sodium deoxycholate, Triton X‐100 and Tween‐80. The amino acid sequence of the N ‐terminus moiety of the 52‐kDa polypeptide was ADNEFPWTNDMLAWQRCGFHFRTVRNYMNDPSGPMYYKGWYHLFYQHNKDFAYXG and the amino acid sequence from the N ‐terminus of the 25‐kDa polypeptide was ADVGYXCSTSGGAATRGTLGPFGLL VLANQDLTENTATYFYVSKGTDGALRTHFCQDET. •  The enzyme tentatively classified as fructan: fructan 6 G ‐fructosyltransferase (6G‐FFT). The enzyme is proposed to play an important role in the synthesis of inulin and inulinneo‐series fructo‐oligosaccharides in onion bulbs.

This content is not available in your region!

Continue researching here.

Having issues? You can contact us here