z-logo
Premium
Primary structure of a photoactive yellow protein from the phototrophic bacterium Ectothiorhodospira halophila , with evidence for the mass and the binding site of the chromophore
Author(s) -
Van Beeumen Jozef J.,
Devreese Bart V.,
Van Bun Stefaan M.,
Hoff Wouter D.,
Hellingwerf Klaas J.,
Meyer Terrance E.,
Cusanovich Michael A.,
Mcree Duncan E.
Publication year - 1993
Publication title -
protein science
Language(s) - English
Resource type - Journals
SCImago Journal Rank - 3.353
H-Index - 175
eISSN - 1469-896X
pISSN - 0961-8368
DOI - 10.1002/pro.5560020706
Subject(s) - chromophore , rhodospirillales , phototroph , purple bacteria , chemistry , biology , bacteria , photochemistry , biophysics , botany , photosynthesis , photosynthetic reaction centre , genetics
The complete amino acid sequence of the 125‐residue photoactive yellow protein (PYP) from Ectothiorhodospira halophila has been determined to be MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKEVIGKNFFKDVAP CTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV. This is the first sequence to be reported for this class of proteins. There is no obvious sequence homology to any other protein, although the crystal structure, known at 2.4Åresolution (McRee, D.E., et al., 1989, Proc. Natl. Acad. Sci. USA 86 , 6533‐6537), indicates a relationship to the similarly sized fatty acid binding protein (FABP), a representative of a family of eukaryotic proteins that bind hydrophobic molecules. The amino acid sequence exhibits no greater similarity between PYP and FABP than for proteins chosen at random (8%). The photoactive yellow protein contains an unidentified chromophore that is bleached by light but recovers within a second. Here we demonstrate that the chromophore is bound covalently to Cys 69 instead of Lys 111 as deduced from the crystal structure analysis. The partially exposed side chains of Tyr 76, 94, and 118, plus Trp 119 appear to be arranged in a cluster and probably become more exposed due to a conformational change of the protein resulting from light‐induced chromophore bleaching. The charged residues are not uniformly distributed on the protein surface but are arranged in positive and negative clusters on opposite sides of the protein. The exact chemical nature of the chromophore remains undetermined, but we here propose a possible structure based on precise mass analysis of a chromophore‐binding peptide by electrospray ionization mass spectrometry and on the fact that the chromophore can be cleaved off the apoprotein upon reduction with a thiol reagent. The molecular mass of the chromophore, including an SH group, is 147.6 Da (+ 0.5 Da); the cysteine residue to which it is bound is at sequence position 69.

This content is not available in your region!

Continue researching here.

Having issues? You can contact us here