Premium
Decorin inhibits cell attachment to thrombospondin‐1 by binding to a KKTR‐dependent cell adhesive site present within the N‐terminal domain of thrombospondin‐1
Author(s) -
Merle Blandine,
Malaval Luc,
Lawler Jack,
Delmas Pierre,
Clezardin Philippe
Publication year - 1997
Publication title -
journal of cellular biochemistry
Language(s) - English
Resource type - Journals
SCImago Journal Rank - 1.028
H-Index - 165
eISSN - 1097-4644
pISSN - 0730-2312
DOI - 10.1002/(sici)1097-4644(19971001)67:1<75::aid-jcb8>3.0.co;2-t
Subject(s) - decorin , chemistry , heparan sulfate , thrombospondin , proteoglycan , binding site , biochemistry , cell adhesion , binding domain , plasma protein binding , chondroitin sulfate , glycosaminoglycan , microbiology and biotechnology , cell , biology , extracellular matrix , metalloproteinase , matrix metalloproteinase
Skin decorin (DCN) is an antiadhesive dermatan sulfate‐rich proteoglycan that interacts with thrombospondin‐1 (TSP) and inhibits fibroblast adhesion to TSP [Winnemöller et al., 1992]. Molecular mechanisms by which DCN interacts with TSP and inhibits cell adhesion to TSP are unknown. In the present study, we showed that skin DCN and bone DCN (chondroitin sulfate‐rich proteoglycan) were quantitatively identical with respect to their ability to interact with TSP. Using a series of fusion proteins corresponding to the different structural domains of TSP, binding of [ 125 I]DCN to TSP was found to be dependent of the N‐terminal domain and, to a lesser extent, of the type 1 repeats and the C‐terminal domain of TSP. In addition, heparan sulfate drastically inhibited [ 125 I]DCN binding to solid‐phase adsorbed TSP (80% inhibition), suggesting that DCN could bind to the N‐terminal domain of TSP through interaction with heparin‐binding sequences. To address this question, a series of synthetic peptides, overlapping heparin‐binding sequences ARKGSGRR (residues 22–29), KKTR (residues 80–83) and RLRIAKGGVNDN (residues 178–189), were synthesized and tested for their ability to interact with DCN. [ 125 I]DCN interacted only with peptides VDAVRTEKGFLLLASLRQMKKTRGT and KKTRGTLLALERKDHS containing the heparin‐binding consensus sequence KKTR. These peptides contained glycosaminoglycan‐dependent and ‐independent binding sites because [ 125 I]DCN binding to VDAVRTEKGFLLLASLRQMKKTRGT and KKTRGTLLALERKDHS was partially reduced upon removal of the glycosaminoglycan chain (65% and 46% inhibition, respectively). [ 125 I]DCN poorly bound to subpeptide MKKTRG and did not bind at all to subpeptides VDAVRTEKGFLLLASLRQ and TLLALERKDHS, suggesting that heparin‐binding sequence MKKTRG constituted a DCN binding site when flanked with peptides VDAVRTEKGFLLLASLRQ and TLLALERKDHS. The sequence VDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHS constitutes a cell adhesive active site in the N‐terminal domain of TSP [Clezardin et al., 1997], and DCN inhibited the attachment of fibroblastic and osteoblastic cells to peptides VDAVRTEKGFLLLASLRQMKKTRGT and KKTRGTLLALERKDHS by about 50 and 80%, respectively. Although fibroblastic cells also attached to type 3 repeats and the C‐terminal domain of TSP, DCN only inhibited cell attachment to the C‐terminal domain. Overall, these data indicate that modulation by steric exclusion of cell adhesion to a KKTR‐dependent cell adhesive site present within the N‐terminal domain of TSP could explain the antiadhesive properties of DCN. J. Cell. Biochem. 67:75–83, 1997. © 1997 Wiley‐Liss, Inc.